PDB entry 3qeg

View 3qeg on RCSB PDB site
Description: Crystal structure of human N12-i2 Fab, an ADCC and neutralizing anti-HIV-1 Env antibody
Class: immune system
Keywords: ADCC and neutralizing anti-HIV-1 Env antibody N12-i2, CD4i antibody, Fab fragment, binds to viral glycoprotein gp120, IMMUNE SYSTEM
Deposited on 2011-01-20, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab fragment of human anti-HIV antibody N12-i2, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEG
  • Chain 'L':
    Compound: Fab fragment of human anti-HIV antibody N12-i2, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QEG (0-End)
    Domains in SCOPe 2.07: d3qegl1, d3qegl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3qegL (L:)
    eivmmqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspetfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qegL (L:)
    eivmmqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspetfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg