PDB entry 3qdd

View 3qdd on RCSB PDB site
Description: HSP90A N-terminal domain in complex with BIIB021
Class: chaperone/chaperone inhibitor
Keywords: ATPase, CHAPERONE-CHAPERONE INHIBITOR complex
Deposited on 2011-01-18, released 2012-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.173
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qdda_
  • Heterogens: 94M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qddA (A:)
    hmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldki
    ryesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafm
    ealqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgep
    mgrgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qddA (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfveke