PDB entry 3qcu

View 3qcu on RCSB PDB site
Description: Crystal structure of the LT3015 antibody Fab fragment in complex with lysophosphatidic acid (14:0)
Class: immune system
Keywords: antibody, lysophosphatidic acid binding, IMMUNE SYSTEM
Deposited on 2011-01-17, released 2011-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.223
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: LT3015 antibody Fab fragment, heavy chain
  Species: Homo sapiens [TaxId:9606]
  Gene: DKFZp686P15220
  Database cross-references and differences (RAF-indexed):
  • PDB 3QCT (0-117)
  • Uniprot Q6N089 (118-222)
• Chain 'I':
  Compound: LT3015 antibody Fab fragment, heavy chain
  Species: Homo sapiens [TaxId:9606]
  Gene: DKFZp686P15220
  Database cross-references and differences (RAF-indexed):
  • PDB 3QCT (0-117)
  • Uniprot Q6N089 (118-222)
• Chain 'L':
  Compound: LT3015 antibody Fab fragment, light chain
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKC
  Database cross-references and differences (RAF-indexed):
  • PDB 3QCT (0-112)
  • Uniprot P01834 (113-217)
  Domains in SCOPe 2.06: d3qcul1, d3qcul2
• Chain 'M':
  Compound: LT3015 antibody Fab fragment, light chain
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKC
  Database cross-references and differences (RAF-indexed):
  • PDB 3QCT (0-112)
  • Uniprot P01834 (113-217)
  Domains in SCOPe 2.06: d3qcum1, d3qcum2
• Heterogens: NKN, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qcuL (L:)
  dvvmtqtplslpvtpgepasisctsgqslvhingntylhwylqkpgqspklliykvsnlf
  sgvpdrfsgsgsgtdftlkisrveaedvgvyfcsqsthfpftfgqgtkleikrtvaapsv
  fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
  sstltlskadyekhkvyacevthqglsspvtksfnrge
  

  
  
• Chain 'M':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3qcuM (M:)
  dvvmtqtplslpvtpgepasisctsgqslvhingntylhwylqkpgqspklliykvsnlf
  sgvpdrfsgsgsgtdftlkisrveaedvgvyfcsqsthfpftfgqgtkleikrtvaapsv
  fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
  sstltlskadyekhkvyacevthqglsspvtksfnrge