PDB entry 3qbt

View 3qbt on RCSB PDB site
Description: Crystal structure of OCRL1 540-678 in complex with Rab8a:GppNHp
Class: protein transport/hydrolase
Keywords: Protein transport, vesicular trafficking, GTPase, Lowe syndrome, immunoglobulin fold, Rab8a, OCRL1, endocytosis, clathrin, APPL1, phosphoinositide, ASH, RhoGAP, PROTEIN TRANSPORT-HYDROLASE complex
Deposited on 2011-01-14, released 2011-03-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: MEL, RAB8, RAB8A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qbta_
  • Chain 'B':
    Compound: Inositol polyphosphate 5-phosphatase OCRL-1
    Species: Homo sapiens [TaxId:9606]
    Gene: INPP5F, OCRL, OCRL1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: MEL, RAB8, RAB8A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qbtc_
  • Chain 'D':
    Compound: Inositol polyphosphate 5-phosphatase OCRL-1
    Species: Homo sapiens [TaxId:9606]
    Gene: INPP5F, OCRL, OCRL1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: MEL, RAB8, RAB8A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qbte_
  • Chain 'F':
    Compound: Inositol polyphosphate 5-phosphatase OCRL-1
    Species: Homo sapiens [TaxId:9606]
    Gene: INPP5F, OCRL, OCRL1
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Ras-related protein Rab-8A
    Species: Homo sapiens [TaxId:9606]
    Gene: MEL, RAB8, RAB8A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3qbtg_
  • Chain 'H':
    Compound: Inositol polyphosphate 5-phosphatase OCRL-1
    Species: Homo sapiens [TaxId:9606]
    Gene: INPP5F, OCRL, OCRL1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GNP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qbtA (A:)
    ghmdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qbtA (A:)
    ylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdtag
    qerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvn
    dkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qbtC (C:)
    ghmdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qbtC (C:)
    dylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdta
    gqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdv
    ndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3qbtE (E:)
    ghmdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qbtE (E:)
    ylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdtag
    qerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvn
    dkrqvskergeklaldygikfmetsakaninvenafftlardikakmdk
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3qbtG (G:)
    ghmdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
    dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
    cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qbtG (G:)
    ylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdtag
    qerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvn
    dkrqvskergeklaldygikfmetsakaninvenafftlardikakmdk
    

  • Chain 'H':
    No sequence available.