PDB entry 3qbf

View 3qbf on RCSB PDB site
Description: HIV-1 protease (mutant Q7K L33I L63I) in complex with a three-armed pyrrolidine-based inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Aspartyl Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-01-13, released 2012-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.179
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d3qbfa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d3qbfb_
  • Heterogens: JHG, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qbfA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qbfB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieicghkaigtvlvgptpvniigrnlltqigctlnf