PDB entry 3qar

View 3qar on RCSB PDB site
Description: Crystal structure of PI3K-gamma in complex with triazine-benzimidazole 32
Class: transferase/transferase inhibitor
Keywords: inhibitor, p110, kinase, transferase, ATP-binding, p84, p101, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-01-11, released 2011-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.237
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qara1, d3qara2, d3qara3, d3qara4
  • Heterogens: SO4, QAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qarA (A:)
    gseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qarA (A:)
    sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
    lpeylwkkianncifivihrsttsqtikvspddtpgailqsfdfvlrvcgrdeylvgetp
    iknfqwvrhclkngeeihvvldtppdpaldevrkeslwdcdrkfrvkirgidipvldltv
    fveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkvqll
    yyvnlllidhrfllrrgeyvlhmwqisfnadkltsatnpdkensmsisilldnpialpkh
    qempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
    aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
    qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
    gtamlhdftqqvqviemlqkvtldikslsadvssqvisqlkqklenlqnsqlpesfrvpy
    dpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqi
    lrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevl
    nhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfgh
    ikervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtg
    mpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvl