PDB entry 3qaa

View 3qaa on RCSB PDB site
Description: HIV-1 wild type protease with a substituted bis-Tetrahydrofuran inhibitor, GRL-044-10A
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic acid protease, HIV-1 protease inhibitor GRL-044-10A, substituted bis-tetrahydrofuran inhibitor, wild-type HIV-1 protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-01-10, released 2011-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.175
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3qaaa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: HUMAN IMMUNODEFICIENCY VIRUS 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3qaab_
  • Heterogens: G04, NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qaaA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qaaB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf