PDB entry 3q97

View 3q97 on RCSB PDB site
Description: Crystal structure of human estrogen receptor alpha LBD in complex with GRIP peptide and two isomers of Ethoxy triphenylethylene
Class: Transcription regulator
Keywords: Transcriptional Regulator, Nuclear Receptor, Transcription regulator
Deposited on 2011-01-07, released 2012-01-11
Made obsolete by 5t1z on 2017-08-30

The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.201
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ER alpha, ESR, ESR1, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (242)
    Domains in SCOPe 2.06: d3q97a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ER alpha, ESR, ESR1, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (242)
    Domains in SCOPe 2.06: d3q97b_
  • Chain 'C':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: Q97, SRR, FMT, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q97A (A:)
    snaikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plsdlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q97A (A:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllem
    ldahrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q97B (B:)
    snaikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrel
    vhminwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnq
    gkcvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdh
    ihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvv
    plsdlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q97B (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtl
    ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemlda
    hr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.