PDB entry 3q85

View 3q85 on RCSB PDB site
Description: Crystal Structure of Rem2 G-domain -GTP Analog Complex
Class: signaling protein
Keywords: G-domain, G-protein, Cav2 beta, SIGNALING PROTEIN
Deposited on 2011-01-06, released 2011-09-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein REM 2
    Species: Mus musculus [TaxId:10090]
    Gene: Rem2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VEL9 (0-168)
      • conflict (89)
    Domains in SCOPe 2.03: d3q85a_
  • Chain 'B':
    Compound: GTP-binding protein REM 2
    Species: Mus musculus [TaxId:10090]
    Gene: Rem2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VEL9 (0-168)
      • conflict (89)
    Domains in SCOPe 2.03: d3q85b_
  • Heterogens: GNP, MG, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q85A (A:)
    gvfkvmlvgesgvgkstlagtfgglqgdhahemensedtyerrimvdkeevtlivydiwe
    qgdaggwlqdhclqtgdaflivfsvtdrrsfskvpetllrlragrphhdlpvilvgnksd
    larsrevsleegrhlagtlsckhietsaalhhntrelfegavrqirlrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q85A (A:)
    gvfkvmlvgesgvgkstlagtfggldtyerrimvdkeevtlivydiweqdhclqtgdafl
    ivfsvtdrrsfskvpetllrlragrphhdlpvilvgnksdlarsrevsleegrhlagtls
    ckhietsaalhhntrelfegavrqirlrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q85B (B:)
    gvfkvmlvgesgvgkstlagtfgglqgdhahemensedtyerrimvdkeevtlivydiwe
    qgdaggwlqdhclqtgdaflivfsvtdrrsfskvpetllrlragrphhdlpvilvgnksd
    larsrevsleegrhlagtlsckhietsaalhhntrelfegavrqirlrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q85B (B:)
    gvfkvmlvgesgvgkstlagtfggldtyerrimvdkeevtlivydiweqlqdhclqtgda
    flivfsvtdrrsfskvpetllrlragrphhdlpvilvgnksdlarsrevsleegrhlagt
    lsckhietsaalhhntrelfegavrqirlrr