PDB entry 3q7v

View 3q7v on RCSB PDB site
Description: Beta-Lactam-Sensor Domain of BlaR1 (Apo) from Staphylococcus Aureus with Carboxylated Lys392
Class: hydrolase regulator
Keywords: antibiotic-binding, MRSA, HYDROLASE REGULATOR
Deposited on 2011-01-05, released 2011-06-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase regulatory protein BlaR1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: blaR1, VRA0048
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WU28 (0-251)
      • engineered mutation (37-38)
      • engineered mutation (40)
    Domains in SCOPe 2.05: d3q7va_
  • Chain 'B':
    Compound: Beta-lactamase regulatory protein BlaR1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: blaR1, VRA0048
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WU28 (0-251)
      • engineered mutation (37-38)
      • engineered mutation (40)
    Domains in SCOPe 2.05: d3q7vb_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q7vA (A:)
    qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
    kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipk
    nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
    sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
    sekilkemgvln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q7vB (B:)
    qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
    kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipk
    nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
    sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
    sekilkemgvln