PDB entry 3q72

View 3q72 on RCSB PDB site
Description: Crystal Structure of Rad G-domain-GTP Analog Complex
Class: signaling protein
Keywords: G-domain, G-protein, Cav2 beta, SIGNALING PROTEIN
Deposited on 2011-01-04, released 2011-09-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.176
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein RAD
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAD, RAD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3q72a_
  • Chain 'B':
    Compound: GTP-binding protein RAD
    Species: Homo sapiens [TaxId:9606]
    Gene: RRAD, RAD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3q72b_
  • Heterogens: GNP, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q72A (A:)
    svykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvydiweqd
    ggrwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnksdlvr
    srevsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q72A (A:)
    svykvlllgapgvgksalarifggvhtydrsivvdgeeaslmvydiwgdayvivysvtdk
    gsfekaselrvqlrrardvpiilvgnksdlvrsrevsvdegracavvfdckfietsaalh
    hnvqalfegvvrqirlrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q72B (B:)
    svykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvydiweqd
    ggrwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnksdlvr
    srevsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q72B (B:)
    svykvlllgapgvgksalarifggvaghtydrsivvdgeeaslmvydiweamgdayvivy
    svtdkgsfekaselrvqlrrarqddvpiilvgnksdlvrsrevsvdegracavvfdckfi
    etsaalhhnvqalfegvvrqirlrr