PDB entry 3q6f

View 3q6f on RCSB PDB site
Description: Crystal structure of Fab of human mAb 2909 specific for quaternary neutralizing epitope of HIV-1 gp120
Class: immune system
Keywords: IgG, neutralization of HIV-1 viruses, Quaternary epitope of HIV-1 gp120, IMMUNE SYSTEM
Deposited on 2010-12-31, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: 0.201
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (Start-212)
    Domains in SCOPe 2.07: d3q6fa1, d3q6fa2
  • Chain 'B':
    Compound: Heavy chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (0-232)
  • Chain 'C':
    Compound: Light chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (Start-212)
    Domains in SCOPe 2.07: d3q6fc1, d3q6fc2
  • Chain 'D':
    Compound: Heavy chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (0-232)
  • Chain 'E':
    Compound: Light chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (Start-212)
    Domains in SCOPe 2.07: d3q6fe1, d3q6fe2
  • Chain 'F':
    Compound: Heavy chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (0-232)
  • Chain 'G':
    Compound: Light chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (Start-212)
    Domains in SCOPe 2.07: d3q6fg1, d3q6fg2
  • Chain 'H':
    Compound: Heavy chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (0-232)
  • Chain 'I':
    Compound: Light chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (Start-212)
    Domains in SCOPe 2.07: d3q6fi1, d3q6fi2
  • Chain 'J':
    Compound: Heavy chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (0-232)
  • Chain 'K':
    Compound: Light chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (Start-212)
    Domains in SCOPe 2.07: d3q6fk1, d3q6fk2
  • Chain 'L':
    Compound: Heavy chain of Fab of human mAb 2909
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q6F (0-232)
  • Heterogens: PEG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q6fA (A:)
    syvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdr
    fsgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6fA (A:)
    yvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdrf
    sgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q6fC (C:)
    syvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdr
    fsgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6fC (C:)
    yvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdrf
    sgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3q6fE (E:)
    syvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdr
    fsgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6fE (E:)
    yvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdrf
    sgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3q6fG (G:)
    syvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdr
    fsgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6fG (G:)
    yvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdrf
    sgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3q6fI (I:)
    syvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdr
    fsgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6fI (I:)
    yvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdrf
    sgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3q6fK (K:)
    syvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdr
    fsgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q6fK (K:)
    yvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdrf
    sgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'L':
    No sequence available.