PDB entry 3q5y

View 3q5y on RCSB PDB site
Description: V beta/V beta homodimerization-based pre-TCR model suggested by TCR beta crystal structures
Class: immune system
Keywords: IG, T cell receptor, antigen peptide/MHC, membrane, IMMUNE SYSTEM
Deposited on 2010-12-30, released 2011-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TCR N15 beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q5Y (0-239)
    Domains in SCOPe 2.07: d3q5ya1, d3q5ya2
  • Chain 'B':
    Compound: TCR N15 beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q5Y
    Domains in SCOPe 2.07: d3q5yb1, d3q5yb2
  • Chain 'C':
    Compound: TCR N15 beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q5Y (Start-239)
    Domains in SCOPe 2.07: d3q5yc1, d3q5yc2
  • Chain 'D':
    Compound: TCR N15 beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q5Y
    Domains in SCOPe 2.07: d3q5yd1, d3q5yd2
  • Heterogens: GOL, PEG, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q5yA (A:)
    mdsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgf
    lpsrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvt
    ppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesn
    ysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrads
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q5yB (B:)
    mdsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgf
    lpsrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvt
    ppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesn
    ysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrads
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q5yB (B:)
    dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
    psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q5yC (C:)
    mdsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgf
    lpsrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvt
    ppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesn
    ysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrads
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q5yC (C:)
    dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
    psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrads
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q5yD (D:)
    mdsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgf
    lpsrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvt
    ppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesn
    ysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrads
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q5yD (D:)
    dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
    psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrad