PDB entry 3q4d

View 3q4d on RCSB PDB site
Description: Crystal structure of dipeptide epimerase from Cytophaga hutchinsonii complexed with Mg and dipeptide D-Ala-L-Ala
Class: isomerase
Keywords: (beta/alpha)8-barrel, Isomerase
Deposited on 2010-12-23, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU2140, CHU_2140, tfdD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q4da1, d3q4da2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU2140, CHU_2140, tfdD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q4db1, d3q4db2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU2140, CHU_2140, tfdD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q4dc1, d3q4dc2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU2140, CHU_2140, tfdD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q4dd1, d3q4dd2
  • Chain 'E':
    Compound: Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU2140, CHU_2140, tfdD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q4de1, d3q4de2
  • Chain 'F':
    Compound: Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU2140, CHU_2140, tfdD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q4df1, d3q4df2
  • Chain 'G':
    Compound: Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU2140, CHU_2140, tfdD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q4dg1, d3q4dg2
  • Chain 'H':
    Compound: Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU2140, CHU_2140, tfdD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q4dh1, d3q4dh2
  • Chain 'I':
    Compound: Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase
    Species: Cytophaga hutchinsonii [TaxId:269798]
    Gene: CHU2140, CHU_2140, tfdD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q4di1, d3q4di2
  • Heterogens: MG, DAL, ALA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q4dA (A:)
    miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
    tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
    flggkkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmirea
    agdsitlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripima
    desccnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlg
    ftaaahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdyls
    glekicin
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q4dB (B:)
    miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
    tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
    flggkkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmirea
    agdsitlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripima
    desccnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlg
    ftaaahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdyls
    glekicin
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q4dC (C:)
    miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
    tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
    flggkkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmirea
    agdsitlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripima
    desccnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlg
    ftaaahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdyls
    glekicin
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q4dD (D:)
    miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
    tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
    flggkkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmirea
    agdsitlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripima
    desccnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlg
    ftaaahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdyls
    glekicin
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q4dE (E:)
    miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
    tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
    flggkkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmirea
    agdsitlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripima
    desccnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlg
    ftaaahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdyls
    glekicin
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q4dF (F:)
    miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
    tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
    flggkkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmirea
    agdsitlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripima
    desccnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlg
    ftaaahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdyls
    glekicin
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q4dG (G:)
    miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
    tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
    flggkkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmirea
    agdsitlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripima
    desccnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlg
    ftaaahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdyls
    glekicin
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q4dH (H:)
    miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
    tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
    flggkkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmirea
    agdsitlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripima
    desccnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlg
    ftaaahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdyls
    glekicin
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q4dI (I:)
    miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
    tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
    flggkkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmirea
    agdsitlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripima
    desccnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlg
    ftaaahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdyls
    glekicin