PDB entry 3q3j

View 3q3j on RCSB PDB site
Description: Crystal structure of plexin A2 RBD in complex with Rnd1
Class: Membrane protein/protein binding
Keywords: Ras-binding domain, plexin, small gtpase, structural genomics consortium, SGC, Membrane protein-protein binding complex
Deposited on 2010-12-21, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plexin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNA2, KIAA0463, OCT, PLXN2, UNQ209/PRO235
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q3ja_
  • Chain 'B':
    Compound: rho-related GTP-binding protein rho6
    Species: Homo sapiens [TaxId:9606]
    Gene: RND1, RHO6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q3jb_
  • Heterogens: UNX, GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q3jA (A:)
    glirqqieyktlilncvnpdnenspeipvkvlncdtitqvkekildavyknvpysqrpra
    vdmdlewrqgriarvvlqdedittkiegdwkrlntlmhyqvsdrsvvalvpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q3jA (A:)
    lirqqieyktlilncvnpdnenspeipvkvlncdtitqvkekildavykqrpravdmdle
    wrqgriarvvlqdedittkikrlntlmhyqvsdrsvvalvpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q3jB (B:)
    mhhhhhhssgrenlyfqgrapqpvvarcklvlvgdvqcgktamlqvlakdcypetyvptv
    fenytacleteeqrvelslwdtsgspyydnvrplcysdsdavllcfdisrpetvdsalkk
    wrteildycpstrvlligcktdlrtdlstlmelshqkqapisyeqgcaiakqlgaeiyle
    gsaftseksihsifrtasmlclnkpsplpqkspv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q3jB (B:)
    rcklvlvgdvqcgktamlqvlakdcypetyvptvfenytacletqrvelslwdtsgspyy
    dnvrplcysdsdavllcfdisrpetvdsalkkwrteildycpstrvlligcktdlrtdls
    tlmelshqkqapisyeqgcaiakqlgaeiylegsaftseksihsifrtasmlcln