PDB entry 3q3b

View 3q3b on RCSB PDB site
Description: 6-Amino-4-(pyrimidin-4-yl)pyridones: Novel Glycogen Synthase Kinase-3 Inhibitors
Class: transferase/transferase inhibitor
Keywords: Kinase, Inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-12-21, released 2011-06-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.228
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3q3ba_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3q3bb_
  • Heterogens: 55E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q3bA (A:)
    gplgssgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q3bA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgevylnlvldyvpetvyrvarhysrakqtlpviyv
    klymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyic
    sryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptr
    eqiremnpnkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffde
    lrdpnvklpngrdtpalfnfttqelssnpplatilipphariqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q3bB (B:)
    gplgssgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q3bB (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgdevylnlvldyvpetvyrvarhysrakqtlpviy
    vklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyi
    csryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtpt
    reqiremnpkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffde
    lrdpnvklpngrdtpalfnfttqelssnpplatilipphar