PDB entry 3q12

View 3q12 on RCSB PDB site
Description: Pantoate-beta-alanine ligase from Yersinia pestis in complex with pantoate.
Class: ligase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, ligase
Deposited on 2010-12-16, released 2011-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantoate--beta-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: panC, y0785, YPO3402, YP_0283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZBK7 (3-286)
      • expression tag (2)
    Domains in SCOPe 2.08: d3q12a1, d3q12a2
  • Chain 'B':
    Compound: Pantoate--beta-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: panC, y0785, YPO3402, YP_0283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZBK7 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.08: d3q12b1, d3q12b2
  • Chain 'C':
    Compound: Pantoate--beta-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: panC, y0785, YPO3402, YP_0283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZBK7 (3-286)
      • expression tag (2)
    Domains in SCOPe 2.08: d3q12c1, d3q12c2
  • Chain 'D':
    Compound: Pantoate--beta-alanine ligase
    Species: Yersinia pestis [TaxId:632]
    Gene: panC, y0785, YPO3402, YP_0283
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZBK7 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.08: d3q12d1, d3q12d2
  • Heterogens: PAF, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3q12A (A:)
    snamliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifv
    nplqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalsti
    legasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvpt
    vrakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvg
    ftpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q12A (A:)
    amliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnp
    lqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstile
    gasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvr
    akdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgft
    pdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3q12B (B:)
    snamliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifv
    nplqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalsti
    legasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvpt
    vrakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvg
    ftpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q12B (B:)
    namliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvn
    plqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstil
    egasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptv
    rakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgf
    tpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3q12C (C:)
    snamliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifv
    nplqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalsti
    legasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvpt
    vrakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvg
    ftpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q12C (C:)
    amliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnp
    lqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstile
    gasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvr
    akdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgft
    pdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3q12D (D:)
    snamliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifv
    nplqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalsti
    legasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvpt
    vrakdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvg
    ftpdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdlrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q12D (D:)
    amliietlpllrqqirrwrqegkrialvptmgnlheghmtlvdeaktradvvvvtifvnp
    lqferpddlahyprtlqedcekltrhgadlvfapaaadiypaglekqtyvdvpalstile
    gasrpghfrgvstivsklfnliqpdvacfgekdyqqlalirkmvadmgydinivgvptvr
    akdglalssrngylteeerqiapqlskimwalaekmalgerqidalleeaaaqllrvgft
    pdelfirdaetlqpltvdsqqavilmaawlgkarlidnqlvdl