PDB entry 3q0h

View 3q0h on RCSB PDB site
Description: Structure of T-cell immunoreceptor with immunoglobulin and ITIM domains (TIGIT)
Class: immune system
Keywords: Immune receptor, adhesion, Structural Genomics, New York Structural Genomics Research Consortium, NYSGRC, PSI-BIOLOGY, IMMUNE SYSTEM
Deposited on 2010-12-15, released 2011-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T cell immunoreceptor with Ig and ITIM domains
    Species: Homo sapiens [TaxId:9606]
    Gene: TIGIT, VSIG9, VSTM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q495A1 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d3q0ha1, d3q0ha2
  • Chain 'B':
    Compound: T cell immunoreceptor with Ig and ITIM domains
    Species: Homo sapiens [TaxId:9606]
    Gene: TIGIT, VSIG9, VSTM3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3q0hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3q0hA (A:)
mmmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhisps
fkdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevlessvaehgar

    Sequence, based on observed residues (ATOM records): (download) 
    >3q0hA (A:)
mmmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhisps
fkdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevles

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3q0hB (B:)
mmmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhisps
fkdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevlessvaehgar

    Sequence, based on observed residues (ATOM records): (download) 
    >3q0hB (B:)
gtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhispsfkdr
vapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevlessv