PDB entry 3pzt

View 3pzt on RCSB PDB site
Description: Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion
Class: hydrolase
Keywords: alpha/beta barrel, glycosyl hydrolase, cellulose binding, HYDROLASE
Deposited on 2010-12-14, released 2011-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.166
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: eglS, bglC, gld, BSU18130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pzta_
  • Chain 'B':
    Compound: endoglucanase
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: eglS, bglC, gld, BSU18130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pztb_
  • Heterogens: MN, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pztA (A:)
    mgsshhhhhhssglvprgshmasaagtktpvakngqlsikgtqlvnrdgkavqlkgissh
    glqwygeyvnkdslkwlrddwgitvfraamytadggyidnpsvknkvkeaveaakelgiy
    viidwhilndgnpnqnkekakeffkemsslygntpnviyeianepngdvnwkrdikpyae
    evisvirkndpdniiivgtgtwsqdvndaaddqlkdanvmyalhfyagthgqflrdkany
    alskgapifvtewgtsdasgnggvfldqsrewlkyldsktiswvnwnlsdkqesssalkp
    gasktggwrlsdlsasgtfvrenilgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pztA (A:)
    ngqlsikgtqlvnrdgkavqlkgisshglqwygeyvnkdslkwlrddwgitvfraamyta
    dggyidnpsvknkvkeaveaakelgiyviidwhilndgnpnqnkekakeffkemsslygn
    tpnviyeianepngdvnwkrdikpyaeevisvirkndpdniiivgtgtwsqdvndaaddq
    lkdanvmyalhfyagthgqflrdkanyalskgapifvtewgtsdasgnggvfldqsrewl
    kyldsktiswvnwnlsdkqesssalkpgasktggwrlsdlsasgtfvrenilg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pztB (B:)
    mgsshhhhhhssglvprgshmasaagtktpvakngqlsikgtqlvnrdgkavqlkgissh
    glqwygeyvnkdslkwlrddwgitvfraamytadggyidnpsvknkvkeaveaakelgiy
    viidwhilndgnpnqnkekakeffkemsslygntpnviyeianepngdvnwkrdikpyae
    evisvirkndpdniiivgtgtwsqdvndaaddqlkdanvmyalhfyagthgqflrdkany
    alskgapifvtewgtsdasgnggvfldqsrewlkyldsktiswvnwnlsdkqesssalkp
    gasktggwrlsdlsasgtfvrenilgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pztB (B:)
    vakngqlsikgtqlvnrdgkavqlkgisshglqwygeyvnkdslkwlrddwgitvfraam
    ytadggyidnpsvknkvkeaveaakelgiyviidwhilndgnpnqnkekakeffkemssl
    ygntpnviyeianepngdvnwkrdikpyaeevisvirkndpdniiivgtgtwsqdvndaa
    ddqlkdanvmyalhfyagthgqflrdkanyalskgapifvtewgtsdasgnggvfldqsr
    ewlkyldsktiswvnwnlsdkqesssalkpgasktggwrlsdlsasgtfvrenilg