PDB entry 3pzo

View 3pzo on RCSB PDB site
Description: Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules
Class: Hydrolase
Keywords: alpha/beta barrel, glycosyl hydrolase, sugar binding, secreted, Hydrolase
Deposited on 2010-12-14, released 2011-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.172
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family 5
    Species: Thermotoga petrophila RKU-1 [TaxId:390874]
    Gene: Tpet_1542
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pzoa_
  • Heterogens: GOL, MAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pzoA (A:)
    mgsshhhhhhssglvprgshmlngkefrfigsnnyymhyksnrmidsvlesardmgikvl
    riwgfldgesycrdkntymhpepgvfgvpegisnaqngferldytiakakelgikliivl
    vnnwddfggmnqyvrwfggthhddfyrderikeeykkyvsflinhvnvytgvpyreepti
    mawelanelrcetdksgntlvewvkemssyiksldpnhlvavgdegffsnyegfkpygge
    aewayngwsgvdwkkllsietvdfgtfhlypshwgvspenyaqwgakwiedhikiakeig
    kpvvleeygipksapvnrtaiyrlwndlvydlggdgamfwmlagigegsdrdergyypdy
    dgfrivnddspeaelireyaklf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pzoA (A:)
    frfigsnnyymhyksnrmidsvlesardmgikvlriwgfldgesycrdkntymhpepgvf
    gvpegisnaqngferldytiakakelgikliivlvnnwddfggmnqyvrwfggthhddfy
    rderikeeykkyvsflinhvnvytgvpyreeptimawelanelrcetdksgntlvewvke
    mssyiksldpnhlvavgdegffsnyegfkpyggeaewayngwsgvdwkkllsietvdfgt
    fhlypshwgvspenyaqwgakwiedhikiakeigkpvvleeygipksapvnrtaiyrlwn
    dlvydlggdgamfwmlagigegsdrdergyypdydgfrivnddspeaelireyaklf