PDB entry 3pza

View 3pza on RCSB PDB site
Description: Fully Reduced (All-ferrous) Pyrococcus rubrerythrin after a 10 second exposure to peroxide.
Class: oxidoreductase
Keywords: Rubrerythrin, OXIDOREDUCTASE
Deposited on 2010-12-14, released 2011-06-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pzaa1, d3pzaa2
  • Chain 'B':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pzab1, d3pzab2
  • Heterogens: PEO, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pzaA (A:)
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pzaB (B:)
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe