PDB entry 3pz8

View 3pz8 on RCSB PDB site
Description: Crystal structure of Dvl1-DIX(Y17D) mutant
Class: signaling protein
Keywords: DIX domain, oligomerization, SIGNALING PROTEIN
Deposited on 2010-12-14, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.232
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Segment polarity protein dishevelled homolog DVL-1
    Species: Mus musculus [TaxId:10090]
    Gene: Dvl1, Dvl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51141 (4-End)
      • engineered mutation (4)
      • engineered mutation (18)
      • expression tag (18)
    Domains in SCOPe 2.07: d3pz8a_
  • Chain 'B':
    Compound: Segment polarity protein dishevelled homolog DVL-1
    Species: Mus musculus [TaxId:10090]
    Gene: Dvl1, Dvl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51141 (4-End)
      • expression tag (1-3)
      • engineered mutation (4)
      • engineered mutation (18)
      • expression tag (18)
    Domains in SCOPe 2.07: d3pz8b1, d3pz8b2
  • Chain 'C':
    Compound: Segment polarity protein dishevelled homolog DVL-1
    Species: Mus musculus [TaxId:10090]
    Gene: Dvl1, Dvl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51141 (4-End)
      • engineered mutation (4)
      • engineered mutation (18)
      • expression tag (18)
    Domains in SCOPe 2.07: d3pz8c_
  • Chain 'D':
    Compound: Segment polarity protein dishevelled homolog DVL-1
    Species: Mus musculus [TaxId:10090]
    Gene: Dvl1, Dvl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51141 (4-End)
      • expression tag (3)
      • engineered mutation (4)
      • engineered mutation (18)
      • expression tag (18)
    Domains in SCOPe 2.07: d3pz8d1, d3pz8d2
  • Chain 'E':
    Compound: Segment polarity protein dishevelled homolog DVL-1
    Species: Mus musculus [TaxId:10090]
    Gene: Dvl1, Dvl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51141 (4-End)
      • expression tag (3)
      • engineered mutation (4)
      • engineered mutation (18)
      • expression tag (18)
    Domains in SCOPe 2.07: d3pz8e1, d3pz8e2
  • Chain 'F':
    Compound: Segment polarity protein dishevelled homolog DVL-1
    Species: Mus musculus [TaxId:10090]
    Gene: Dvl1, Dvl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51141 (4-End)
      • expression tag (1-3)
      • engineered mutation (4)
      • engineered mutation (18)
      • expression tag (18)
    Domains in SCOPe 2.07: d3pz8f1, d3pz8f2
  • Chain 'G':
    Compound: Segment polarity protein dishevelled homolog DVL-1
    Species: Mus musculus [TaxId:10090]
    Gene: Dvl1, Dvl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51141 (4-End)
      • engineered mutation (4)
      • engineered mutation (18)
      • expression tag (18)
    Domains in SCOPe 2.07: d3pz8g_
  • Chain 'H':
    Compound: Segment polarity protein dishevelled homolog DVL-1
    Species: Mus musculus [TaxId:10090]
    Gene: Dvl1, Dvl
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51141 (4-End)
      • engineered mutation (4)
      • engineered mutation (18)
      • expression tag (18)
    Domains in SCOPe 2.07: d3pz8h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pz8A (A:)
    gphmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgv
    vkeeifddnaklpcfngrvvswlvlaegahsdagsqgtdshtdlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz8A (A:)
    dtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkee
    ifddnaklpcfngrvvswlvla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pz8B (B:)
    gphmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgv
    vkeeifddnaklpcfngrvvswlvlaegahsdagsqgtdshtdlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz8B (B:)
    phmdtkiiyhmdeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvk
    eeifddnaklpcfngrvvswlvlae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pz8C (C:)
    gphmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgv
    vkeeifddnaklpcfngrvvswlvlaegahsdagsqgtdshtdlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz8C (C:)
    dtkiiyhmdeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkeei
    fddnaklpcfngrvvswlvla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pz8D (D:)
    gphmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgv
    vkeeifddnaklpcfngrvvswlvlaegahsdagsqgtdshtdlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz8D (D:)
    mdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvke
    eifddnaklpcfngrvvswlvla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3pz8E (E:)
    gphmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgv
    vkeeifddnaklpcfngrvvswlvlaegahsdagsqgtdshtdlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz8E (E:)
    mdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvke
    eifddnaklpcfngrvvswlvla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3pz8F (F:)
    gphmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgv
    vkeeifddnaklpcfngrvvswlvlaegahsdagsqgtdshtdlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz8F (F:)
    phmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvv
    keeifddnaklpcfngrvvswlvla
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3pz8G (G:)
    gphmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgv
    vkeeifddnaklpcfngrvvswlvlaegahsdagsqgtdshtdlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz8G (G:)
    dtkiiyhmdeeetpdlvklpvapervtladfknvlsnrphaykfffksmdqdfgvvkeei
    fddnaklpcfngrvvswlvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3pz8H (H:)
    gphmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgv
    vkeeifddnaklpcfngrvvswlvlaegahsdagsqgtdshtdlpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz8H (H:)
    dtkiiyhmdetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgvvkeeif
    dnaklpcfngrvvswlvlaeg