SCOPe 2.08: Structural Classification of Proteins

PDB entry 3pz8

View 3pz8 on RCSB PDB site
Description: Crystal structure of Dvl1-DIX(Y17D) mutant
Class: signaling protein
Keywords: DIX domain, oligomerization, SIGNALING PROTEIN
Deposited on 2010-12-14, released 2010-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.232
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Segment polarity protein dishevelled homolog DVL-1
Species: Mus musculus [TaxId:10090]
Gene: Dvl1, Dvl
Database cross-references and differences (RAF-indexed):
- Uniprot P51141 (4-End)
  - engineered mutation (4)
  - engineered mutation (18)
  - expression tag (18)
Domains in SCOPe 2.08: d3pz8a_
Chain 'B':
Compound: Segment polarity protein dishevelled homolog DVL-1
Species: Mus musculus [TaxId:10090]
Gene: Dvl1, Dvl
Database cross-references and differences (RAF-indexed):
- Uniprot P51141 (4-End)
  - expression tag (1-3)
  - engineered mutation (4)
  - engineered mutation (18)
  - expression tag (18)
Domains in SCOPe 2.08: d3pz8b1, d3pz8b2
Chain 'C':
Compound: Segment polarity protein dishevelled homolog DVL-1
Species: Mus musculus [TaxId:10090]
Gene: Dvl1, Dvl
Database cross-references and differences (RAF-indexed):
- Uniprot P51141 (4-End)
  - engineered mutation (4)
  - engineered mutation (18)
  - expression tag (18)
Domains in SCOPe 2.08: d3pz8c_
Chain 'D':
Compound: Segment polarity protein dishevelled homolog DVL-1
Species: Mus musculus [TaxId:10090]
Gene: Dvl1, Dvl
Database cross-references and differences (RAF-indexed):
- Uniprot P51141 (4-End)
  - expression tag (3)
  - engineered mutation (4)
  - engineered mutation (18)
  - expression tag (18)
Domains in SCOPe 2.08: d3pz8d1, d3pz8d2
Chain 'E':
Compound: Segment polarity protein dishevelled homolog DVL-1
Species: Mus musculus [TaxId:10090]
Gene: Dvl1, Dvl
Database cross-references and differences (RAF-indexed):
- Uniprot P51141 (4-End)
  - expression tag (3)
  - engineered mutation (4)
  - engineered mutation (18)
  - expression tag (18)
Domains in SCOPe 2.08: d3pz8e1, d3pz8e2
Chain 'F':
Compound: Segment polarity protein dishevelled homolog DVL-1
Species: Mus musculus [TaxId:10090]
Gene: Dvl1, Dvl
Database cross-references and differences (RAF-indexed):
- Uniprot P51141 (4-End)
  - expression tag (1-3)
  - engineered mutation (4)
  - engineered mutation (18)
  - expression tag (18)
Domains in SCOPe 2.08: d3pz8f1, d3pz8f2
Chain 'G':
Compound: Segment polarity protein dishevelled homolog DVL-1
Species: Mus musculus [TaxId:10090]
Gene: Dvl1, Dvl
Database cross-references and differences (RAF-indexed):
- Uniprot P51141 (4-End)
  - engineered mutation (4)
  - engineered mutation (18)
  - expression tag (18)
Domains in SCOPe 2.08: d3pz8g_
Chain 'H':
Compound: Segment polarity protein dishevelled homolog DVL-1
Species: Mus musculus [TaxId:10090]
Gene: Dvl1, Dvl
Database cross-references and differences (RAF-indexed):
- Uniprot P51141 (4-End)
  - engineered mutation (4)
  - engineered mutation (18)
  - expression tag (18)
Domains in SCOPe 2.08: d3pz8h_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3pz8A (A:)
gphmdtkiiyhmdeeetpdlvklpvapervtladfknvlsnrpvhaykfffksmdqdfgv
vkeeifddnaklpcfngrvvswlvlaegahsdagsqgtdshtdlpp