PDB entry 3pz7

View 3pz7 on RCSB PDB site
Description: Crystal structure of Ccd1-DIX domain
Class: signaling protein
Keywords: DIX domain, oligomerization, SIGNALING PROTEIN
Deposited on 2010-12-14, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.235
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dixin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q155Q3 (4-End)
      • expression tag (1-3)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d3pz7a1, d3pz7a2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pz7A (A:)
    gphmsstctkvlyftdrsltpfmvnipkrleevtlkdfkaaidregnhryhfkamdpefg
    tvkeeifhdddaipgwegkivawveedhgen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pz7A (A:)
    phmsstctkvlyftdrsltpfmvnipkrleevtlkdfkaaidregnhryhfkamdpefgt
    vkeeifhdddaipgwegkivawveed