PDB entry 3pyp

View 3pyp on RCSB PDB site
Description: photoactive yellow protein, cryotrapped early light cycle intermediate
Deposited on 1998-07-28, released 1999-06-01
The last revision prior to the SCOP 1.59 freeze date was dated 1999-06-01, with a file datestamp of 1999-05-31.
Experiment type: XRAY
Resolution: 0.85 Å
R-factor: 0.1326
AEROSPACI score: 1.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d3pyp__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3pyp_ (-)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv