PDB entry 3py0

View 3py0 on RCSB PDB site
Description: CDK2 in complex with inhibitor SU9516
Class: transferase/transferase inhibitor
Keywords: protein kinase, CDK2, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-12-10, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.212
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3py0a_
  • Heterogens: EDO, PO4, SU9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3py0A (A:)
    gplgspefmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstairei
    sllkelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqll
    qglafchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrape
    illgckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvts
    mpdykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkp
    vphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3py0A (A:)
    menfqkvekigegtygvvykarnkltgevvalkkirtegvpstaireisllkelnhpniv
    klldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshrvl
    hrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystav
    diwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwa
    rqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl