PDB entry 3pxn

View 3pxn on RCSB PDB site
Description: Crystal structure of the Drosophila kinesin family member Kin10/NOD in complex with divalent manganese and ADP
Class: motor protein
Keywords: kinesin, motor domain, ATP hydrolysis, meiosis, spindle protein, ATP-binding, cell cycle, cell division, microtubule, motor protein, nucleotide-binding, Alpha/Beta Class
Deposited on 2010-12-10, released 2011-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein Nod
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: nod, NODA, CG1763
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18105 (Start-336)
      • expression tag (337-338)
    Domains in SCOPe 2.07: d3pxna1, d3pxna2
  • Heterogens: MN, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pxnA (A:)
    masdykddddkrrrgmegaklsavriavreapyrqflgrrepsvvqfppwsdgkslivdq
    nefhfdhafpatisqdemyqalilplvdkllegfqctalaygqtgtgksysmgmtppgei
    lpehlgilpralgdifervtarqennkdaiqvyasfieiynekpfdllgstphmpmvaar
    cqrctclplhsqadlhhilelgtrnrrvrptnmnsnssrshaivtihvkskthhsrmniv
    dlagsegvrrtghegvarqegvninlgllsinkvvmsmaaghtvipyrdsvlttvlqasl
    taqsyltflacisphqcdlsetlstlrfgtsakklrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxnA (A:)
    aklsavriavreapyrpsvvqfppwsdgkslivdqnefhfdhafpatisqdemyqalilp
    lvdkllegfqctalaygqtgtgksysmgmtppgeilpehlgilpralgdifervtarqen
    nkdaiqvyasfieiynekpfdllgstphmpmvaarcqrctclplhsqadlhhilelgtrn
    rrsrshaivtihvkskthhsrmnivdlagsegvvninlgllsinkvvmsmaaghtvipyr
    dsvlttvlqasltaqsyltflacisphqcdlsetlstlrfgtsakklrleh