PDB entry 3pxj

View 3pxj on RCSB PDB site
Description: Tandem Ig repeats of Dlar
Class: hydrolase
Keywords: Ig domains, Cell adhesion, Receptor protein tyrosine phosphatase, HYDROLASE
Deposited on 2010-12-10, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase Lar
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Lar, CG10443
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pxja1, d3pxja2
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase Lar
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Lar, CG10443
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pxjb1, d3pxjb2
  • Chain 'C':
    Compound: Tyrosine-protein phosphatase Lar
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Lar, CG10443
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pxjc1, d3pxjc2
  • Chain 'D':
    Compound: Tyrosine-protein phosphatase Lar
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Lar, CG10443
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pxjd1, d3pxjd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pxjA (A:)
    gpgsaahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsgtqsrytvle
    qpggisilriepvragrddapyecvaengvgdavsadatltiyegdktpagfpvitqgpg
    trvievghtvlmtckaignptpniywiknqtkvdmsnpryslkdgflqiensreedqgky
    ecvaensmgtehskatnlyvkvrrvpptfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxjA (A:)
    aahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsgtqsrytvleqpgg
    isilriepvragrddapyecvaengvgdavsadatltiyegdktpagfpvitqgpgtrvi
    evghtvlmtckaignptpniywiknqtkvdmsnpryslkdgflqiensreedqgkyecva
    ensmgtehskatnlyvkvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pxjB (B:)
    gpgsaahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsgtqsrytvle
    qpggisilriepvragrddapyecvaengvgdavsadatltiyegdktpagfpvitqgpg
    trvievghtvlmtckaignptpniywiknqtkvdmsnpryslkdgflqiensreedqgky
    ecvaensmgtehskatnlyvkvrrvpptfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxjB (B:)
    aahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsgtqsrytvleqpgg
    isilriepvragrddapyecvaengvgdavsadatltiyegdktpagfpvitqgpgtrvi
    evghtvlmtckaignptpniywiknqtkvdmsnpryslkdgflqiensreedqgkyecva
    ensmgtehskatnlyvkvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pxjC (C:)
    gpgsaahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsgtqsrytvle
    qpggisilriepvragrddapyecvaengvgdavsadatltiyegdktpagfpvitqgpg
    trvievghtvlmtckaignptpniywiknqtkvdmsnpryslkdgflqiensreedqgky
    ecvaensmgtehskatnlyvkvrrvpptfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxjC (C:)
    ahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsrytvleqpggisilr
    iepvragrddapyecvaeavsadatltiyektpagfpvitqgpgtrvievghtvlmtcka
    ignptpniywiknqtkvdmsnpryslkdgflqiensreedqgkyecvaensmgtehskat
    nlyvkvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pxjD (D:)
    gpgsaahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsgtqsrytvle
    qpggisilriepvragrddapyecvaengvgdavsadatltiyegdktpagfpvitqgpg
    trvievghtvlmtckaignptpniywiknqtkvdmsnpryslkdgflqiensreedqgky
    ecvaensmgtehskatnlyvkvrrvpptfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxjD (D:)
    ahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsgsrytvleqpggisi
    lriepvragrddapyecvaengvgdavsadatltiyektpagfpvitqgpgtrvievght
    vlmtckaignptpniywiknqtkvdmsnpryslkdgflqiensreedqgkyecvaensmg
    tehskatnlyvkvr