PDB entry 3pxh

View 3pxh on RCSB PDB site
Description: Tandem Ig domains of tyrosine phosphatase LAR
Class: hydrolase
Keywords: Ig domains, Cell adhesion, Receptor protein tyrosine phosphatase, HYDROLASE
Deposited on 2010-12-09, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase F
    Species: Mus musculus [TaxId:10090]
    Gene: PTPRF, LAR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pxha1, d3pxha2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pxhA (A:)
    gpgsdskpvfvkvpedqtglsggvasfvcqatgepkpritwmkkgkkvssqrfeviefdd
    gagsvlriqplrvqrdeaiyectatnslgeintsaklsvleedqlpsgfptidmgpqlkv
    vekgrtatmlcaaggnpdpeiswfkdflpvdpaasngrikqlrsgalqiesseesdqgky
    ecvatnsagtrysapanlyvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxhA (A:)
    dskpvfvkvpedqtglsggvasfvcqatgepkpritwmkkgkkvssqrfeviefddgags
    vlriqplrvqrdeaiyectatnslgeintsaklsvleedqlpsgfptidmgpqlkvvekg
    rtatmlcaaggnpdpeiswfkdflpvdpaasngrikqlrsgalqiesseesdqgkyecva
    tnsagtrysapanlyvr