PDB entry 3pxf

View 3pxf on RCSB PDB site
Description: CDK2 in complex with two molecules of 8-anilino-1-naphthalene sulfonate
Class: transferase
Keywords: protein kinase, allosteric ligand, TRANSFERASE
Deposited on 2010-12-09, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (8-305)
      • expression tag (4-7)
    Domains in SCOPe 2.07: d3pxfa1, d3pxfa2
  • Heterogens: EDO, 2AN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pxfA (A:)
    gplgspefmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstairei
    sllkelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqll
    qglafchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrape
    illgckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvts
    mpdykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkp
    vphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pxfA (A:)
    spefmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl