PDB entry 3pwv

View 3pwv on RCSB PDB site
Description: An immmunodominant CTL epitope from rinderpest virus presented by cattle MHC class I molecule N*01801 (BoLA-A11)
Class: immune system
Keywords: MHC BoLA-A11 conformation cattle, immunodominant epitope, IMMUNE SYSTEM
Deposited on 2010-12-09, released 2011-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.191
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Bos taurus [TaxId:9913]
    Gene: LA-A11
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 9-mer peptide from Hemagglutinin
    Species: Rinderpest virus, synthetic [TaxId:11241]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: MHC class I antigen
    Species: Bos taurus [TaxId:9913]
    Gene: LA-A11
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pwve_
  • Chain 'F':
    Compound: 9-mer peptide from Hemagglutinin
    Species: Rinderpest virus, synthetic [TaxId:11241]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pwvE (E:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl
    

  • Chain 'F':
    No sequence available.