PDB entry 3pwu

View 3pwu on RCSB PDB site
Description: An immmunodominant CTL epitope from rinderpest virus presented by cattle MHC class I molecule N*01801(BoLA-A11)
Class: immune system
Keywords: MHC BoLA conformation, immunodominant epitope cattle, IMMUNE SYSTEM
Deposited on 2010-12-09, released 2011-08-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Bos taurus [TaxId:9913]
    Gene: LA-A11
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3pwub_
  • Chain 'C':
    Compound: IPA from Hemagglutinin glycoprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pwuB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.