PDB entry 3pwm

View 3pwm on RCSB PDB site
Description: HIV-1 Protease Mutant L76V with Darunavir
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1, protease, mutation L76V, darunavir, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-12-08, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.143
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (75)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3pwma_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (75)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3pwmb_
  • Heterogens: CL, ACT, NA, 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pwmA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pwmB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf