PDB entry 3puh

View 3puh on RCSB PDB site
Description: Cocaine Esterase, wild-type biologically active dimer
Class: hydrolase
Keywords: alpha/beta hydrolase, jelly-roll beta-barrel, Cleavage of cocaine, HYDROLASE
Deposited on 2010-12-04, released 2011-09-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cocaine esterase
    Species: Rhodococcus sp. [TaxId:104109]
    Gene: cocE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3puha1, d3puha2
  • Chain 'B':
    Compound: cocaine esterase
    Species: Rhodococcus sp. [TaxId:104109]
    Gene: cocE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3puhb1, d3puhb2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3puhA (A:)
    mvdgnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwl
    efvrdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylg
    vtqwqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtglitsrsd
    arpedaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsisl
    ferlgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfg
    iaatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdwplpdtaytp
    fylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhngdngpadqrp
    ihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdgraialcdgi
    vrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpkydrnsntgg
    viareqleemctavnrihrgpehpshivlpiikrklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3puhA (A:)
    gnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwlefv
    rdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylgvtq
    wqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtglitsrsdarp
    edaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsislfer
    lgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfgiaa
    typiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdwplpdtaytpfyl
    ggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhngdngpadqrpihd
    rddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdgraialcdgivrm
    ryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpkydrnsntggvia
    reqleemctavnrihrgpehpshivlpiikr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3puhB (B:)
    mvdgnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwl
    efvrdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylg
    vtqwqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtglitsrsd
    arpedaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsisl
    ferlgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfg
    iaatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdwplpdtaytp
    fylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhngdngpadqrp
    ihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdgraialcdgi
    vrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpkydrnsntgg
    viareqleemctavnrihrgpehpshivlpiikrklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3puhB (B:)
    mvdgnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwl
    efvrdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylg
    vtqwqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtglitsrsd
    arpedaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsisl
    ferlgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfg
    iaatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdwplpdtaytp
    fylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhngdngpadqrp
    ihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdgraialcdgi
    vrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpkydrnsntgg
    viareqleemctavnrihrgpehpshivlpiikr