PDB entry 3puc

View 3puc on RCSB PDB site
Description: Atomic resolution structure of titin domain M7
Class: transferase
Keywords: I-set Ig-like domain, M-band, TRANSFERASE
Deposited on 2010-12-04, released 2011-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3puca1, d3puca2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pucA (A:)
    gpisskpvivtglqdttvssdsvakfavkatgeprptaiwtkdgkaitqggkyklsedkg
    gffleihktdtsdsglytctvknsagsvsssckltikai
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pucA (A:)
    gpisskpvivtglqdttvssdsvakfavkatgeprptaiwtkdgkaitqggkyklsedkg
    gffleihktdtsdsglytctvknsagsvsssckltika