PDB entry 3ptm

View 3ptm on RCSB PDB site
Description: The crystal structure of rice (Oryza sativa L.) Os4BGlu12 with 2-fluoroglucopyranoside
Class: hydrolase
Keywords: beta-alpha barrel, glycosidase, hydrolase
Deposited on 2010-12-03, released 2011-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase Os4BGlu12
    Species: Oryza sativa [TaxId:4530]
    Gene: Os04g0474800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ptma_
  • Chain 'B':
    Compound: Beta-glucosidase Os4BGlu12
    Species: Oryza sativa [TaxId:4530]
    Gene: Os04g0474800
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ptmb_
  • Heterogens: G2F, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ptmA (A:)
    amaditslykkagsaaapfaynsageppvsrrsfpkgfifgtasssyqyeggaaeggrgp
    siwdtfthqhpekiadrsngdvasdsyhlykedvrlmkdmgmdayrfsiswtrilpngsl
    rggvnkegikyynnlinellskgvqpfitlfhwdspqaledkyngflspniindfkdyae
    icfkefgdrvknwitfnepwtfcsngyatglfapgrcspwekgncsvgdsgrepytachh
    qllahaetvrlykakyqalqkgkigitlvshwfvpfsrsksnndaakraidfmfgwfmdp
    lirgdyplsmrglvgnrlpqftkeqsklvkgafdfiglnyytanyadnlppsnglnnsyt
    tdsranltgvrngipigpqaaspwlyvypqgfrdlllyvkenygnptvyitengvdefnn
    ktlplqealkddarieyyhkhllsllsairdganvkgyfawslldnfewsngytvrfgin
    fvdyndgrkrypknsahwfkkfllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ptmA (A:)
    pvsrrsfpkgfifgtasssyqyeggaaeggrgpsiwdtfthqhpekiadrsngdvasdsy
    hlykedvrlmkdmgmdayrfsiswtrilpngslrggvnkegikyynnlinellskgvqpf
    itlfhwdspqaledkyngflspniindfkdyaeicfkefgdrvknwitfnepwtfcsngy
    atglfapgrcspwekgncsvgdsgrepytachhqllahaetvrlykakyqalqkgkigit
    lvshwfvpfsrsksnndaakraidfmfgwfmdplirgdyplsmrglvgnrlpqftkeqsk
    lvkgafdfiglnyytanyadnlppsnglnnsyttdsranltgvrngipigpqaaspwlyv
    ypqgfrdlllyvkenygnptvyitengvdefnnktlplqealkddarieyyhkhllslls
    airdganvkgyfawslldnfewsngytvrfginfvdyndgrkrypknsahwfkkfllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ptmB (B:)
    amaditslykkagsaaapfaynsageppvsrrsfpkgfifgtasssyqyeggaaeggrgp
    siwdtfthqhpekiadrsngdvasdsyhlykedvrlmkdmgmdayrfsiswtrilpngsl
    rggvnkegikyynnlinellskgvqpfitlfhwdspqaledkyngflspniindfkdyae
    icfkefgdrvknwitfnepwtfcsngyatglfapgrcspwekgncsvgdsgrepytachh
    qllahaetvrlykakyqalqkgkigitlvshwfvpfsrsksnndaakraidfmfgwfmdp
    lirgdyplsmrglvgnrlpqftkeqsklvkgafdfiglnyytanyadnlppsnglnnsyt
    tdsranltgvrngipigpqaaspwlyvypqgfrdlllyvkenygnptvyitengvdefnn
    ktlplqealkddarieyyhkhllsllsairdganvkgyfawslldnfewsngytvrfgin
    fvdyndgrkrypknsahwfkkfllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ptmB (B:)
    pvsrrsfpkgfifgtasssyqyeggaaeggrgpsiwdtfthqhpekiadrsngdvasdsy
    hlykedvrlmkdmgmdayrfsiswtrilpngslrggvnkegikyynnlinellskgvqpf
    itlfhwdspqaledkyngflspniindfkdyaeicfkefgdrvknwitfnepwtfcsngy
    atglfapgrcspwekgncsvgdsgrepytachhqllahaetvrlykakyqalqkgkigit
    lvshwfvpfsrsksnndaakraidfmfgwfmdplirgdyplsmrglvgnrlpqftkeqsk
    lvkgafdfiglnyytanyadnlppsnglnnsyttdsranltgvrngipigpqaaspwlyv
    ypqgfrdlllyvkenygnptvyitengvdefnnktlplqealkddarieyyhkhllslls
    airdganvkgyfawslldnfewsngytvrfginfvdyndgrkrypknsahwfkkfllk