PDB entry 3pro

View 3pro on RCSB PDB site
Description: alpha-lytic protease complexed with c-terminal truncated pro region
Deposited on 1998-08-26, released 1999-04-27
The last revision prior to the SCOP 1.65 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3proA (A:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
    anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3proB (B:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
    anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3proC (C:)
    adqvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgs
    fklvaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswy
    vdprsnavvvkvddgatdagvdfvalsgadsaqvriesspgklqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3proC (C:)
    pqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklva
    atsgarksstlggvevrnvryslkqlqsameqldaganaldgvqswyvdprsnavvvkvd
    dgatdagvdfvalsgadsaqvriesspgkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3proD (D:)
    adqvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgs
    fklvaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswy
    vdprsnavvvkvddgatdagvdfvalsgadsaqvriesspgklqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3proD (D:)
    qvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfk
    lvaatsgarksstlggvevrnvryslkqlqsameqldaganldgvqswyvdprsnavvvk
    vddgatdagvdfvalsgadsaqvriesspgkl