PDB entry 3pro

View 3pro on RCSB PDB site
Description: alpha-lytic protease complexed with c-terminal truncated pro region
Class: hydrolase/hydrolase inhibitor
Keywords: PRO REGION, FOLDASE, PROTEIN FOLDING, SERINE PROTEASE, hydrolase-hydrolase inhibitor complex
Deposited on 1998-08-26, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00778 (0-197)
      • mutation (157)
    Domains in SCOPe 2.07: d3proa_
  • Chain 'B':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00778 (0-197)
      • mutation (157)
    Domains in SCOPe 2.07: d3prob_
  • Chain 'C':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3proc1, d3proc2
  • Chain 'D':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3prod1, d3prod2
  • Heterogens: AES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3proA (A:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
    anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3proB (B:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
    anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3proC (C:)
    adqvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgs
    fklvaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswy
    vdprsnavvvkvddgatdagvdfvalsgadsaqvriesspgklqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3proC (C:)
    pqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklva
    atsgarksstlggvevrnvryslkqlqsameqldaganaldgvqswyvdprsnavvvkvd
    dgatdagvdfvalsgadsaqvriesspgkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3proD (D:)
    adqvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgs
    fklvaatsgarksstlggvevrnvryslkqlqsameqldaganarvkgvskpldgvqswy
    vdprsnavvvkvddgatdagvdfvalsgadsaqvriesspgklqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3proD (D:)
    qvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfk
    lvaatsgarksstlggvevrnvryslkqlqsameqldaganldgvqswyvdprsnavvvk
    vddgatdagvdfvalsgadsaqvriesspgkl