PDB entry 3prl

View 3prl on RCSB PDB site
Description: Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from Bacillus halodurans C-125
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, dehydrogenase, PSI-biology, New York Structural Genomics Research Consortium, NYSGRC, OXIDOREDUCTASE
Deposited on 2010-11-29, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.251
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BAB05956.1, BH2237, gapN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3prla_
  • Chain 'B':
    Compound: NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BAB05956.1, BH2237, gapN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KAQ0 (Start-482)
      • expression tag (483)
    Domains in SCOPe 2.07: d3prlb1, d3prlb2
  • Chain 'C':
    Compound: NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BAB05956.1, BH2237, gapN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3prlc_
  • Chain 'D':
    Compound: NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BAB05956.1, BH2237, gapN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KAQ0 (Start-482)
      • expression tag (483-487)
    Domains in SCOPe 2.07: d3prld1, d3prld2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3prlA (A:)
    mvmalqteqfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakd
    aqkiwkirpihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirht
    adealrlngetlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtg
    ntvvfkpatqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftgg
    tttgerisekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvf
    vqdsvadqlvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsg
    nkrqgnllsptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasift
    kdtdrainigkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtv
    lnlaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3prlA (A:)
    qfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakdaqkiwkir
    pihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirhtadealrln
    getlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtgntvvfkpa
    tqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftggtttgeris
    ekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvfvqdsvadq
    lvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsgnkrqgnll
    sptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasiftkdtdrain
    igkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtvlnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3prlB (B:)
    mvmalqteqfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakd
    aqkiwkirpihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirht
    adealrlngetlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtg
    ntvvfkpatqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftgg
    tttgerisekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvf
    vqdsvadqlvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsg
    nkrqgnllsptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasift
    kdtdrainigkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtv
    lnlaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3prlB (B:)
    qfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakdaqkiwkir
    pihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirhtadealrln
    getlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtgntvvfkpa
    tqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftggtttgeris
    ekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvfvqdsvadq
    lvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsgnkrqgnll
    sptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasiftkdtdrain
    igkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtvlnla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3prlC (C:)
    mvmalqteqfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakd
    aqkiwkirpihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirht
    adealrlngetlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtg
    ntvvfkpatqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftgg
    tttgerisekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvf
    vqdsvadqlvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsg
    nkrqgnllsptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasift
    kdtdrainigkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtv
    lnlaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3prlC (C:)
    qfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakdaqkiwkir
    pihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirhtadealrln
    getlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtgntvvfkpa
    tqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftggtttgeris
    ekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvfvqdsvadq
    lvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsgnkrqgnll
    sptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasiftkdtdrain
    igkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtvlnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3prlD (D:)
    mvmalqteqfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakd
    aqkiwkirpihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirht
    adealrlngetlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtg
    ntvvfkpatqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftgg
    tttgerisekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvf
    vqdsvadqlvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsg
    nkrqgnllsptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasift
    kdtdrainigkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtv
    lnlaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3prlD (D:)
    qfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakdaqkiwkir
    pihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirhtadealrln
    getlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtgntvvfkpa
    tqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftggtttgeris
    ekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvfvqdsvadq
    lvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsgnkrqgnll
    sptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasiftkdtdrain
    igkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtvlnlaenly