PDB entry 3prg

View 3prg on RCSB PDB site
Description: ligand binding domain of human peroxisome proliferator activated receptor
Class: nuclear receptor
Keywords: thiazolidinedione, nuclear receptor, transcription factor, adipocyte differentiation
Deposited on 1998-08-24, released 1999-08-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.209
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3prga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3prgA (A:)
    avhylnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllk
    ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
    ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
    tdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3prgA (A:)
    avhylnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkiskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytml
    aslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiav
    iilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehv
    qllqvikktetdmslhpllqeiykdly