PDB entry 3pqk

View 3pqk on RCSB PDB site
Description: Crystal Structure of the transcriptional repressor BigR from Xylella fastidiosa
Class: transcription
Keywords: helix-turn-helix motif, winged-helix fold, transcriptional repressor, DNA binding, TRANSCRIPTION
Deposited on 2010-11-26, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.211
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pqka_
  • Chain 'B':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pqkb_
  • Chain 'C':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pqkc_
  • Chain 'D':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pqkd_
  • Chain 'E':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pqke_
  • Chain 'F':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pqkf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pqkA (A:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqkA (A:)
    edmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvlres
    givetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pqkB (B:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqkB (B:)
    tredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvlr
    esgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pqkC (C:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqkC (C:)
    tredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvlr
    esgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pqkD (D:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqkD (D:)
    tredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvlr
    esgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3pqkE (E:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqkE (E:)
    tredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvlr
    esgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3pqkF (F:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqkF (F:)
    redmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvlre
    sgivetrrnikqifyrlteakaaqlvnalytifcaqekqa