PDB entry 3pqj

View 3pqj on RCSB PDB site
Description: Crystal Structure of the transcriptional repressor BigR from Xylella fastidiosa
Class: transcription
Keywords: helix-turn-helix motif, winged-helix fold, transcriptional repressor, DNA binding, TRANSCRIPTION
Deposited on 2010-11-26, released 2011-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqja_
  • Chain 'B':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqjb_
  • Chain 'C':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqjc_
  • Chain 'D':
    Compound: Biofilm growth-associated repressor
    Species: Xylella fastidiosa [TaxId:2371]
    Gene: bigR, XF_0767
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pqjd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pqjA (A:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqjA (A:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pqjB (B:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqjB (B:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigiqqlgvlresgiv
    etrrnikqifyrlteakaaqlvnalytifca
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pqjC (C:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqjC (C:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pqjD (D:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigigqptlsqqlgvl
    resgivetrrnikqifyrlteakaaqlvnalytifcaqekqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqjD (D:)
    mtredmekranevanllktlshpvrlmlvctlvegefsvgeleqqigiqqlgvlresgiv
    etrrnikqifyrlteakaaqlvnalytifc