PDB entry 3pqe

View 3pqe on RCSB PDB site
Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis with H171C mutation
Class: oxidoreductase
Keywords: L-lactate dehydrogenase, FBP, OXIDOREDUCTASE
Deposited on 2010-11-26, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13714
      • engineered mutation (170)
    Domains in SCOPe 2.07: d3pqea1, d3pqea2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13714
      • engineered mutation (170)
    Domains in SCOPe 2.07: d3pqeb1, d3pqeb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13714
      • engineered mutation (170)
    Domains in SCOPe 2.07: d3pqec1, d3pqec2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ldh, lctE, BSU03050
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13714
      • engineered mutation (170)
    Domains in SCOPe 2.07: d3pqed1, d3pqed2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pqeA (A:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqeA (A:)
    nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
    ktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflva
    tnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgdt
    elpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsla
    ritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflh
    sagvlknilkphfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pqeB (B:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqeB (B:)
    nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
    ktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflva
    tnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgdt
    elpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsla
    ritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflh
    sagvlknilkphfa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pqeC (C:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqeC (C:)
    nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
    ktsygtyedckdadivcicaganlelveknlkifkgivsevmasgfdgiflvatnpvdil
    tyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwsh
    anvggvpvselvekndykqeeldqivddvknaayhiiekkgatyygvamslaritkailh
    nensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhsagvlkni
    lkphf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pqeD (D:)
    mnkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqp
    vktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflv
    atnpvdiltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgd
    telpvwshanvggvpvselvekndaykqeeldqivddvknaayhiiekkgatyygvamsl
    aritkailhnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqfl
    hsagvlknilkphfaeqkvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pqeD (D:)
    nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
    ktsygtyedckdadivcicaganrlelveknlkifkgivsevmasgfdgiflvatnpvdi
    ltyatwkfsglpkervigsgttldsarfrfmlseyfgaapqnvcahiigehgdtelpvws
    hanvggvpvselvekndykqeeldqivddvknaayhiiekkgatyygvamslaritkail
    hnensiltvstyldgqygaddvyigvpavvnrggiagitelnlnekekeqflhsagvlkn
    ilkphf