PDB entry 3pnc

View 3pnc on RCSB PDB site
Description: Ternary crystal structure of a polymerase lambda variant with a GT mispair at the primer terminus and sodium at catalytic metal site
Class: lyase,transferase/DNA
Keywords: PROTEIN-DNA COMPLEX, LYASE, TRANSFERASE, DNA, LYASE,TRANSFERASE-DNA complex
Deposited on 2010-11-18, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-328)
      • see remark 999 (221-222)
      • see remark 999 (223-224)
    Domains in SCOPe 2.07: d3pnca1, d3pnca2, d3pnca3
  • Chain 'B':
    Compound: 5'-d(*cp*ap*gp*tp*ap*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*gp*gp*cp*cp*tp*tp*ap*cp*tp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*cp*cp*g)-3'
  • Heterogens: 1GC, MG, NA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pncA (A:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrh
    rrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvg
    pgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pncA (A:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivv
    pysefacallyftgsahfnrsmralaktkgmslsehalstavvrkvgpgrvlptptekdv
    frllglpyrepaerdw
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.