PDB entry 3pn8

View 3pn8 on RCSB PDB site
Description: The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159
Class: hydrolase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, (beta/alpha)8 barrel, Beta-Glucosidase, cytoplasmic, HYDROLASE
Deposited on 2010-11-18, released 2010-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.165
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative phospho-beta-glucosidase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: bgl, SMU_1601, Streptococcus mutans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DT00 (3-479)
      • expression tag (2)
    Domains in SCOPe 2.07: d3pn8a1, d3pn8a2
  • Chain 'B':
    Compound: Putative phospho-beta-glucosidase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: bgl, SMU_1601, Streptococcus mutans
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pn8b_
  • Heterogens: SO4, PEG, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pn8A (A:)
    snamsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyy
    pnheaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdec
    lkygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfnei
    nnqanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcm
    vamcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdk
    kdlfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglr
    yalnwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvel
    mgytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pn8A (A:)
    amsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypn
    heaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclk
    ygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinn
    qanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmva
    mcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkd
    lfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglrya
    lnwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvelmg
    ytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pn8B (B:)
    snamsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyy
    pnheaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdec
    lkygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfnei
    nnqanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcm
    vamcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdk
    kdlfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglr
    yalnwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvel
    mgytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pn8B (B:)
    msklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypnh
    eaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclky
    giepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinnq
    anyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmvam
    cpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkdl
    fegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglryal
    nwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvelmgy
    tpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi