PDB entry 3pmv

View 3pmv on RCSB PDB site
Description: Ligand-binding domain of GluA2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator
Class: transport protein
Keywords: Transport protein, Membrane protein, Fusion protein, chimera protein
Deposited on 2010-11-18, released 2011-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • linker (117-118)
    • Uniprot P19491 (119-262)
    Domains in SCOPe 2.08: d3pmva1, d3pmva2
  • Heterogens: GLU, SO4, 557, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pmvA (A:)
ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlk
lseqgvldklknkwwydkgecga