PDB entry 3pml

View 3pml on RCSB PDB site
Description: crystal structure of a polymerase lambda variant with a dGTP analog opposite a templating T
Class: lyase,transferase/DNA
Keywords: PROTEIN-DNA COMPLEX, LYASE, TRANSFERASE, DNA, LYASE,TRANSFERASE-DNA complex
Deposited on 2010-11-17, released 2011-01-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-328)
      • see remark 999 (221-222)
      • see remark 999 (223-224)
    Domains in SCOPe 2.05: d3pmla1, d3pmla2, d3pmla3
  • Chain 'B':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-328)
      • see remark 999 (221-222)
      • see remark 999 (223-224)
    Domains in SCOPe 2.05: d3pmlb1, d3pmlb2, d3pmlb3
  • Chain 'C':
    Compound: 5'-d(*cp*gp*gp*cp*tp*gp*tp*ap*cp*tp*g)-3'
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'E':
    Compound: 5'-d(*cp*gp*gp*cp*tp*gp*tp*ap*cp*tp*g)-3'
  • Chain 'F':
    Compound: 5'-d(*cp*ap*gp*tp*ap*c)-3'
  • Chain 'G':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'H':
    Compound: 5'-d(*cp*ap*gp*tp*ap*c)-3'
  • Heterogens: 1GC, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pmlA (A:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrh
    rrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvg
    pgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pmlA (A:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiiv
    vpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlpt
    ptekdvfrllglpyrepaerdw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pmlB (B:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrh
    rrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvg
    pgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pmlB (B:)
    qkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgig
    krmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsq
    aslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcg
    dvdvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldi
    ivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvl
    ptptekdvfrllglpyrepaerdw
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.