PDB entry 3pme

View 3pme on RCSB PDB site
Description: Crystal structure of the receptor binding domain of botulinum neurotoxin C/D mosaic serotype
Class: toxin
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, botulinum Neurotoxin, receptor binding domain, ganglioside, phosphatidylethanolamine, mosaic serotype, TOXIN
Deposited on 2010-11-16, released 2010-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.178
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type C neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5DW55 (Start-413)
      • expression tag (414-417)
    Domains in SCOPe 2.06: d3pmea1, d3pmea2, d3pmea3
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pmeA (A:)
    sindskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnni
    lysaiyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrky
    kslifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktiv
    fgidenidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkfdteyymi
    nynyidryiapknnilvlvqysdisklytknpitiksaanknpysrilngddimfhmlyd
    sreymiirdtdtiyatqggqcskncvyalklqsnlgnygigifsiknivsqnkycsqifs
    sfmkntmlladiykpwrfsfenaytpvavtnyetkllstssfwkfisrdpgwvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pmeA (A:)
    indskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnnil
    ysaiyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrkyk
    slifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktivf
    gidenidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkfdteyymin
    ynyidryiapknnilvlvqysdisklytknpitiksaanknpysrilngddimfhmlyds
    reymiirdtdtiyatqggqcskncvyalklqsnlgnygigifsiknivsqycsqifssfm
    kntmlladiykpwrfsfenaytpvavtnyetkllstssfwkfisrdpgwvehhhh