PDB entry 3plz

View 3plz on RCSB PDB site
Description: Human LRH1 LBD bound to GR470
Class: transcription/receptor/agonist
Keywords: alpha helical sandwhich, nuclear receptor, family five, transcription factor, co-activator, TRANSCRIPTION-RECEPTOR-AGONIST complex
Deposited on 2010-11-15, released 2011-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.187
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FTZ-F1 related protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NR5A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3plza_
  • Chain 'B':
    Compound: FTZ-F1 related protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NR5A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3plzb_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 470, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3plzA (A:)
    mkkghhhhhhlvprgsiphlilellkcepdepqvqakimaylqqeqanrskheklstfgl
    mckmadqtlfsivewarssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsif
    lvtgqqvdysiiasqagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknl
    enfqlvegvqeqvnaalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlng
    dvpynnlliemlhakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3plzA (A:)
    siphlilellkcepdepqvqakimaylqqeklstfglmckmadqtlfsivewarssiffr
    elkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqagatlnnl
    mshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaalldytmc
    nypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3plzB (B:)
    mkkghhhhhhlvprgsiphlilellkcepdepqvqakimaylqqeqanrskheklstfgl
    mckmadqtlfsivewarssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsif
    lvtgqqvdysiiasqagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknl
    enfqlvegvqeqvnaalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlng
    dvpynnlliemlhakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3plzB (B:)
    siphlilellkcepdepqvqakimaylqqeqanrkheklstfglmckmadqtlfsivewa
    rssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiiasqa
    gatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvnaa
    lldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlhakr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.