SCOPe 2.08: Structural Classification of Proteins

PDB entry 3pkp

View 3pkp on RCSB PDB site
Description: Q83S Variant of S. Enterica RmlA with dATP
Class: transferase
Keywords: nucleotidylyltransferase, Directed evolution, Structural Genomics, PSI-2, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, TRANSFERASE
Deposited on 2010-11-11, released 2011-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Gene: rfbA, rmlA, STM2095
Database cross-references and differences (RAF-indexed):
- Uniprot P26393 (0-End)
  - engineered mutation (82)
  - variant (82)
Domains in SCOPe 2.08: d3pkpa_
Chain 'B':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Gene: rfbA, rmlA, STM2095
Database cross-references and differences (RAF-indexed):
- Uniprot P26393
  - engineered mutation (82)
  - variant (82)
Domains in SCOPe 2.08: d3pkpb_
Chain 'C':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Gene: rfbA, rmlA, STM2095
Database cross-references and differences (RAF-indexed):
- Uniprot P26393
  - engineered mutation (82)
  - variant (82)
Domains in SCOPe 2.08: d3pkpc_
Chain 'D':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Gene: rfbA, rmlA, STM2095
Database cross-references and differences (RAF-indexed):
- Uniprot P26393
  - engineered mutation (82)
  - variant (82)
Domains in SCOPe 2.08: d3pkpd_
Chain 'I':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Gene: rfbA, rmlA, STM2095
Database cross-references and differences (RAF-indexed):
- Uniprot P26393
  - engineered mutation (82)
  - variant (82)
Domains in SCOPe 2.08: d3pkpi_
Chain 'J':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Gene: rfbA, rmlA, STM2095
Database cross-references and differences (RAF-indexed):
- Uniprot P26393
  - engineered mutation (82)
  - variant (82)
Domains in SCOPe 2.08: d3pkpj_
Chain 'K':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Gene: rfbA, rmlA, STM2095
Database cross-references and differences (RAF-indexed):
- Uniprot P26393
  - engineered mutation (82)
  - variant (82)
Domains in SCOPe 2.08: d3pkpk_
Chain 'L':
Compound: glucose-1-phosphate thymidylyltransferase
Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
Gene: rfbA, rmlA, STM2095
Database cross-references and differences (RAF-indexed):
- Uniprot P26393
  - engineered mutation (82)
  - variant (82)
Domains in SCOPe 2.08: d3pkpl_
Heterogens: DTP, MG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3pkpA (A:)
mktrkgiilaggsgtrlypvtmavskqllpiydkpmiyyplstlmlagirdiliistpqd
tprfqqllgdgsqwglnlqykvspspdglaqafiigeefighddcalvlgdnifyghdlp
klmeaavnkesgatvfayhvndperygvvefdqkgtavsleekplqpksnyavtglyfyd
nsvvemaknlkpsargeleitdinriymeqgrlsvammgrgyawldtgthqslieasnfi
atieerqglkvscpeeiafrknfinaqqvielagplskndygkyllkmvkgl