PDB entry 3pit

View 3pit on RCSB PDB site
Description: Crystal structure of M-RasD41E in complex with GppNHp (type 2)
Class: signaling protein
Keywords: GTP-binding, GTPase, SIGNALING PROTEIN
Deposited on 2010-11-08, released 2011-03-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.186
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein M-Ras
    Species: Mus musculus [TaxId:10090]
    Gene: Mras, Xras
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08989 (Start-182)
      • engineered mutation (45)
    Domains in SCOPe 2.04: d3pita_
  • Heterogens: GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pitA (A:)
    gplgsmatsavpsenlptyklvvvgdggvgksaltiqffqkifvpeydptiedsylkhte
    idnqwaildvldtagqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkd
    resfpmilvankvdlmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvi
    rqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pitA (A:)
    lptyklvvvgdggvgksaltiqffqkifvpeydptiedsylkhteidnqwaildvldtag
    qeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdl
    mhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq